PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 886426
Common NameARALYDRAFT_685870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LFY
Protein Properties Length: 427aa    MW: 47075.7 Da    PI: 6.9386
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
886426genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY618.41.3e-18813961386
  FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldll 102
              mdpe f++ lf+w+p  a++a+p  + +  +++  p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++m+sls+ifr++ll
   886426   1 MDPEGFTSGLFRWNPTRAMVAAPPPVPPPPQQQ--PATPQMAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEMMNSLSHIFRWELL 100
              9*************7777666555565554433..33356677778888***************************************************** PP

  FLO_LFY 103 vGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqe....glseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkq 193
              vGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqe    glseepvq+++++ ++g++g g ++   a ++k+   kk++ + ++
   886426 101 VGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaagDSGTHHALDALSQEddwtGLSEEPVQQQNQTDAAGNNGGGGSGYWEAGQAKM---KKQQ-Q-QR 197
              ******************99544456778887778844344556*******988889*******98876666666656666666653322...2222.2.22 PP

  FLO_LFY 194 krkkkkelkseededeeeeededeeg......sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfrya 289
              +rkk   ++ e+d+d +e +d+d+++      +g  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak+rGekcPtkvtnqvfrya
   886426 198 RRKKPMVTSVETDDDVNEGDDDDGMDngngggGGGLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYA 299
              22222222333333333333333333112222555667**************************************************************** PP

  FLO_LFY 290 kkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
              kk+gasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
   886426 300 KKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 396
              *********************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.5E-2001395IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV AAPPPVPPPP QQQPATPQMA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEEMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLLLSAAGDS GTHHALDALS QEDDWTGLSE EPVQQQNQTD AAGNNGGGGS  180
GYWEAGQAKM KKQQQQRRRK KPMVTSVETD DDVNEGDDDD GMDNGNGGGG GGLGTERQRE  240
HPFIVTEPGE VARGKKNGLD YLFHLYEQCR EFLLQVQTIA KDRGEKCPTK VTNQVFRYAK  300
KSGASYINKP KMRHYVHCYA LHCLDEDASN ALRRAFKERG ENVGSWRQAC YKPLVNIACR  360
HGWDIDAVFN AHPRLSIWYV PTKLRQLCHL ERNNAVAAAA ALVGGISCTG SSTSGRGGCG  420
GDDLRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1452334261194PROTEIN LEAFY
2vy2_A1e-1452334261194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4471030.0DQ447103.1 Arabidopsis thaliana clone pENTR221-At5g61850 floral meristem identity control protein LEAFY (At5g61850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864757.10.0predicted protein
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLD7MKN50.0D7MKN5_ARALL; Predicted protein
STRINGAl_scaffold_0008_26900.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)